SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10008460|PACid:23155031 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10008460|PACid:23155031
Domain Number 1 Region: 12-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10008460|PACid:23155031
Sequence length 128
Sequence
MEFPREEDIVQPLKFFKIIRRESLKDKKLMIPREFVRQCGRDLKGKATLLAPDGLRWDMK
IVKDDGDDRNLKFWFKNGWQAFAEYYSLSHGEFISFQYNGGRNTSSLEFSITIFDEKAEK
ERDYPSME
Download sequence
Identical sequences Lus10008460|PACid:23155031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]