SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10011245|PACid:23147120 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10011245|PACid:23147120
Domain Number 1 Region: 329-431
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-18
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 666-768
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-18
Family B3 DNA binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  Lus10011245|PACid:23147120
Domain Number - Region: 8-15
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0228
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10011245|PACid:23147120
Sequence length 1331
Sequence
MTTPSPSPPPPPPPPSAPYLPPPTAPAAPTWAKCFNSVCSEKKSKKAWRLRSGEQAELCE
PCFAAYEEGRFCETFHLNDSGWRCCESCRKRVHCGCIVSVSAFTLLDAGGIECVTCARKH
AVVTSSNPTWQTAFYYHGYIADRGKDASVKKLNYLAKSGPVPWRQAPSLFNSSITQTVAH
PMFHSEADRLNATEKLSSASLEKGKPDNSVNGNTKHSSGDKIENGHPGPSNVERQSSSIR
EDSSTSQIGFSRTYTSINETKGKEPGCSTIPMPATSLAIVVHNGGGDAPVEPRPRGRPRG
KSQLLPRYWPRFTNEELQRISGKTNAVITPLFEKMLSASDAGRVGRLVLPKKCAETYLPP
ISQAEGLPLKVHDYTGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMFLQAGDIVTFSRLD
PGGKLVMGFRKAINVNPPSSEYPAISNAQDTESTNPPTGTSGNGEGEVSDRPPWYKVDKS
DYIATPSEVIAAKPSSKKRKNSSSVSGSKGKSLKMGSDDLIQLQVTWEESQGLLRPPAEH
PSPSSVVSIDGYDFEEFEEAPVIGKPAILATDKAGWGSAAVAEGGGTDVILEEGGAMTTK
HPRHKPGCSCIVCIQPPSGKGPKHKPVEPRPRGRPRGKSQLLPRYWPRFTNEELQRISGK
TNAVITPLFEKMLSASDAGRVGRLVLPKKCAETYLPPISQAEGLPLKVHDYTGKEWVFQF
RFWPNNNSRMYVLEGVTPCIQSMFLQAGDIVTFSRLDPGGKLVMGFRKAINVNPPSSEYP
AISNAQDSESTNPPAGTSGNGEGEVSDRPPWYKVDKSDYIATPSEVIAAKPSSKKRKNSS
SVSGSKGKSLKMGSDDLIQLQVTWEESQGLLRPPAEHPSPSSVVSIDGYDFEEFEEAPVI
GKPAILATDKAGNKFQWTQCEDCSKWRKIPLDALLPFQWTCSRNLWDLEKYIYIGTLRPL
MAQIACIPSLVLNCDSNALSFRASCVADQESSRELLKDLLPPQPLAAPKKLKAAAIPEKD
GGEAAVAAGGGTDVILEEGGAMTTKHPRQKPGCSCIVCIQPPSGKGPKHKPDCTCTVCEA
VKRRFTTQQIKRNERKEAESKQLKQLPPPPAQQLPETTGGHDDDDDDDADPLNSGETGNN
SSGSNEASKRMKSASSSPFKGRIDLNIKPEREEEALPALDSVFTKTLHNVEEMSASRPQK
VSSSPTSGSDGPRQPEETTTSPPNDASQLASKLILDAALQMKVVSQTYGNDGNNTQQLAT
GDQILVAAGEGKSTESDDSSLAKLTEEALPASASPQQLLDSNLPNSNKPATPPNPQSTTS
LDCPTRLTTTQ
Download sequence
Identical sequences Lus10011245|PACid:23147120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]