SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10011888|PACid:23169185 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10011888|PACid:23169185
Domain Number 1 Region: 555-651
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-21
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10011888|PACid:23169185
Sequence length 709
Sequence
MHEEEDLYAADQIWAPEQDPGNNLLDGSIFYKGADGGSGGGDFPPLPDFPTMSSSSSSTS
SMPPATTVKPPPTPSAAAAMSTSSSASSESSHTNHNNNNSSYCYYEDNSNVYNTDQMVDT
PCAGALSSTASMEISEQLPPVGLESIDCCMDGMDDFGCMDLLMDPIFGGGDHLDGFQQQY
ESQDGVVPVQQQAKDAAAVGEEDLGEVFLEWLKNNKESVSADDLRRIKIKKSTIDSAAKR
LGGGKEAMKQLLKLILEWVQMNHLHRRRSNKYDNTEADVAVENSDPAPPPLPTSYDNYHQ
STTQDNTGYLDPVNPWATASDPVVGYPYGMGSDPFGNNGGGVVGPNFNANYGVHQHQSTD
YNFTSQVNESAQSWPSSRFPTPAPSPPVHYGGGRFDGFTQPGGFSGYLNQNQYPYPYLSA
ATAEQSGGGGQCRGGDTNGLVRMGSSATKEARKKRMARQRRFIPHHHRNHHTTGAGLAEN
QVGAGLVQQQQQGNLVYWPMPPQTGINGPGLVPMDGSAVVQTVDRPAVQNQNHQKQGGAS
DKRKGWKAEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELDARDGISIAMEDIGT
SRVWNMRYSLRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYLIRGVKVR
QPAGLTKPENKKAATAANGSKSQRKPPANSSSAANNKTTTPVQQLDTYR
Download sequence
Identical sequences Lus10011888|PACid:23169185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]