SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10012040|PACid:23161494 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10012040|PACid:23161494
Domain Number 1 Region: 59-141
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000167
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 8-60
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.00000000772
Family Arp2/3 complex 16 kDa subunit ARPC5 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10012040|PACid:23161494
Sequence length 227
Sequence
MAGADGFVEAENAEAIITRIEHKSRKIESLLKQYKPVEALKTALEGSPPKTGDERCKPLP
IKFATKHGRKLAMKEWSNAKLCLPNGTVFEAGITAGKDHNDLWFKTGWSKFMDDNSIKEK
FVLAFEYVGESRFNIRIFDLSMSKILYTPQPPAVVAGECEALLDELAARGIHVANKFSCM
TFPIISSESKRAMQEAMKNKREDDAVPSFIVVMNPCGGKNSKRPTAL
Download sequence
Identical sequences Lus10012040|PACid:23161494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]