SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10015248|PACid:23178799 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10015248|PACid:23178799
Domain Number 1 Region: 138-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000165
Family B3 DNA binding domain 0.0078
Further Details:      
 
Weak hits

Sequence:  Lus10015248|PACid:23178799
Domain Number - Region: 18-54
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000118
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10015248|PACid:23178799
Sequence length 224
Sequence
MNRNRRKQQSLKPQLGGAFARDNGLKIGDVCAFEVPRKGETEKPTLNVVIFRADQGVDRD
VHPPVDIQPKSAVLLSDREGAEACSSHGFRNVPNEAKLTIDKRSLTVKPCDKDRSGNLRK
QSNRILQSHGGLEAANAFTSDLPLFKVVMSRAYLSKSFVTIPVEFHKHINEDKAELWVEG
LRWGVKIANYTVSGYARKIISTGWKSFANANSLKRGDACIFESL
Download sequence
Identical sequences Lus10015248|PACid:23178799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]