SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10022820|PACid:23160041 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10022820|PACid:23160041
Domain Number 1 Region: 223-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-23
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10022820|PACid:23160041
Sequence length 374
Sequence
MGIDPFGNNGGGVVGPNFNANYGVHQHQSTDYNFTSQVIESAQSWPSSRFPTPAPSPPVH
YGGGGFDSYTQPGGFSGYLNQNQYPYPYLSAATAGQSVGGGQCGGGDTNGLVRMGSSATK
EARKKRMARQRRFIPHHHRNHHNTGVSLAESQVGPGLVQQQQGNLVYWPMRPQTGISGPG
SVPMDGSAVAVDRPAVQNQNHQKQGGASDKRKGWKAEKNLRFLLQKVLKQSDVGSLGRIV
LPKKEAETHLPELDARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRANG
LQEGDFIVIYSDVKCGKYLIRGVKVRQPAGLTKPENKKAATAANGSKSQRKPPANSSSAA
NNKTTPVQQLDTYR
Download sequence
Identical sequences Lus10022820|PACid:23160041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]