SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10024902|PACid:23178894 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10024902|PACid:23178894
Domain Number 1 Region: 31-221
Classification Level Classification E-value
Superfamily SIS domain 2.16e-22
Family mono-SIS domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10024902|PACid:23178894
Sequence length 235
Sequence
MGSLPPSLDDLPSLPPSDPKHNQIEESTLLKLFKSQQRHLNYFFRHLDLTQALTFTHTLL
NSPGTIFFTGVGKSGFVANKISQTLISLGIRPSFLNPFDALHGDIGTLSSLDILVLFSKS
GNTEELLRLVPCARDVKDVMKKQNELPVCREGDLIMDQLVELTSKGCGCLLVIHPDQHRL
IGTFTDGDLRRTLKASGEGIFKLTVGEMCNRRPRTIGPDAMAVEAMKKMESPSTD
Download sequence
Identical sequences Lus10024902|PACid:23178894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]