SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10026724|PACid:23176646 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10026724|PACid:23176646
Domain Number 1 Region: 161-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000049
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10026724|PACid:23176646
Sequence length 260
Sequence
MASTISFPCMQRIPRKFISTEFGQQLLGCDAATLEVRFPLETNGKLGWRGIDKGSFGSTT
MHGGDLQSSTLWTMATSSLSIVTCDISATEIVYPTLSNVDRVVEIERDDSLSLEIVGEVD
DTAANEKGKSPIVDDSAETIINEEKEGTNLDDDASGNLFGSGHTLFEIKIKASHLCSRQQ
RRIPLSFTMEHSFMREVEQVKMEVGDNVWPVRVRLACNMYVLIPAGWIRFAEDNSLKLGD
VCVFKVMATSPEVRTIIRGV
Download sequence
Identical sequences Lus10026724|PACid:23176646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]