SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10026921|PACid:23142842 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10026921|PACid:23142842
Domain Number 1 Region: 256-357
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0079
Further Details:      
 
Domain Number 2 Region: 103-184
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000471
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10026921|PACid:23142842
Sequence length 366
Sequence
MVLDVMAFDPSLVERKYHFAAPPHVSVKIEAEQFPTDLVEPNTDHCTLGTPREKNAVKAS
LAGKSGSAGTKRPEIAKKNPTHGEKKRAEARLAGNTPTAEPNDHCFDYLPRKFVSANGIV
GKSSETVVVDGKGAKWPARLVTLQNTNAEVKLKDGWKEYVTENRLKLGDSLSVELVRGGT
NPVFRITGLGRIPMENPRMNVEEVKKEPNHEESAAAEMSSRDRSLNIKVSGCALNLENEK
PVHEEPAPPAAFMYPQDGTKSFVVTLTNVSIKGGYLVIPQEFAVQNGLNVVSCNVSISNE
AGIPYPVTLNIIKSGTTYLGGNGWTKLVETNCLRIGDVLRFELNEAGQKPVMNFKVSCLF
PSPIPF
Download sequence
Identical sequences Lus10026921|PACid:23142842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]