SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10027543|PACid:23144493 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10027543|PACid:23144493
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 183-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000149
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 376-456
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000275
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10027543|PACid:23144493
Sequence length 516
Sequence
MPTDPFREGKLQLPEKFAREHGSELANEVLLKLPNGAEWPVSVVKSSRKKIWFDKGWSKF
AKFYSLEPTNFLVFQLADHNHFKVMIVDTSATGINYSKKKSNANVVPETNEAVERNQPSS
PKAQGTASGMKADRNRSSNPRRPKPLTVDKEASGILGKANVCLNLKIPPSREFISVCLML
YVGWFLFKWQNVPVAFFETNFVENSVDIFLQLANVGLWKGKYFVIDYGYAKRAYFEAKSW
GSFARANCLRVGDMCAFELVEVDNEARFNVVIFRTSPSLVGNGKTTVIPATESGFTYKQQ
KHGHSPRTSDKQHLTSPHPIKLRRRIGVKRTATTSKGQNQSRVPRIEAPLIIAKKAGFLA
RAKAVFTSDSPTTRLFVETNFVNQCGDIVLQVPGVGGEWTVKYLVRGSGNLKRAVLQTES
WTSFAEDTGLKVGDVCAFELVEFDTKPRLNVVIFRASRVANRCHRSGIGPTTKATTSKNS
TSPEWKSGCTSKSERHESSHGSTEGLRTGELGDEVA
Download sequence
Identical sequences Lus10027543|PACid:23144493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]