SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10030321|PACid:23153162 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10030321|PACid:23153162
Domain Number 1 Region: 436-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-17
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10030321|PACid:23153162
Sequence length 627
Sequence
MPNTAVSRPVKIIPLQHPSVGTTSSSSTSPSTFFSGLLTKWKRLTFLQFIECLFPCSRWI
RTYRWRQDFQVDLVAGLTIGVMLVPQAMSYAKLAGLEPIYGLYTGFVPIFVYAVFGSSRQ
LAIGPVALVSLLVSNVLRGIAGSSDELYTELAIVLALMVGILECIMGLLRLGWLLRFISH
SVISGFTTASAFVIGLSQAKYFLGYNITQSSKIVPLIKSIIAGADKFSWPPFVMGSGIVA
VLLIMKHLIGEIPQGLPSFAVPKNFGYAKSLIPTAFLITGVAILLVGLGLANIFGSFFSS
YPSTGSFSRSAVSNESGAKTGLSGIITGIVMGCALLFLTPLFEFIPQCALAAIVVSAVIG
LVEYEEAIFLWRVDKKDFLLWIITCTMTLFLGIEIGVLVGVGVSLAFVIHESANPHIAVL
GRLPGTTVYRNIQQYPEAYTYHGIVIVRIDAPIYFANTSFIKDRLRDYEVSVDTSARRGP
EVERIYFVILEMSPVTYIDSSAIQALKDLHLEYKSRDIQIAISNPNREVLLTLSKAGIVE
LIGKEWYFVRVHDAVQICLQHVQSLHQTPDTTLAETKPNLLERLLKQRGDDSPASDLESG
KRSVVASRSNDPNLVPLLPPHRFNPEE
Download sequence
Identical sequences Lus10030321|PACid:23153162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]