SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10031017|PACid:23166828 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10031017|PACid:23166828
Domain Number 1 Region: 6-55,101-185
Classification Level Classification E-value
Superfamily POZ domain 7.38e-20
Family BTB/POZ domain 0.026
Further Details:      
 
Domain Number 2 Region: 306-390
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-18
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10031017|PACid:23166828
Sequence length 511
Sequence
MSLEDSFRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLFFRKFFCSPPTD
HTPNSPSSAGSGSGSPSSGSRPIPVVIGAGSPTSRHNQQTSNNNNNNNNVIPVNSVGYEV
FLLMLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCSSAVDLVLDTLSAARYFGVEQLAL
LSQKQLATMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPAEVLAKHLPIDVV
AKIEELRLKSSLSRRSGSSSSHHHVMSHHHHGHHDMAADIEDQKIRRMRRALDSSDVELV
KLMVMGEGLNLDEALALHYAVESCSREVVKALLELGAADVNYPAGPAGKTPLHVAAEMVS
PDMVAVLLDHHADPNVRTVDGVTPLDVLRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQ
SAALVISREEGSTSDCGAGVAQGGSVAGAIYPPSGGMSGGSGNLNLDSRLVYLNLGANAG
SRMEQEDESQNRHDSTMYHHQQHQHHHHQHF
Download sequence
Identical sequences Lus10031017|PACid:23166828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]