SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10032098|PACid:23161177 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10032098|PACid:23161177
Domain Number 1 Region: 256-352
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-19
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 75-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10032098|PACid:23161177
Sequence length 591
Sequence
MTVLQVKKEQDAKGKTPMMKMNDILSFTKQEGSIIQIKSTLSQTGKKATKESIYVNSEVE
KAVMMKAKRIESSLPRNYPTMIKVMLPSHVTGGFWLGLMKGFCDKHLPDDDTMMDLEDEN
GEVRQAKFLANKPGLSGGWKGFSISHQLVIGDVIVFQLVKPTRFKVHIARASGLEENAVV
GLLQTDNIKEQVDSGDANSNSIGASDSSDTDSLVVPSKSTISKTRERVAVDRLYNDVEVE
NLVLLKAQEVKASLPKNFPTMIKVMLPSHVAGGFSLSLTKGFGAKHLPHEDTMLDLEDED
GKIHTAKYLVHRQGLSGGWRAFSIDHKLVPGDVLVFQLVEPTKFKVYIARASGSDEVDVA
LGLLQMDSDGEKMISDNLPKGYRESNSEGHQSDDGFGFDISDGIRMFESTAIDFEQVKSF
DDFDIVVNGLVINCELSKHLRLKYYELCSSQKLFLHAHILSGLNCKLIVGVIAETINIAD
AIRASKFSGGALQQMEDFLTWEKTLMAFEKLGMNVEFILTRLRQLMGLCGNASRHKRLRT
ERIQIEEEVEILKAKLEESVERIKRIDGEMEVDEVDVEVKFGDLAEAPWSL
Download sequence
Identical sequences Lus10032098|PACid:23161177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]