SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10032748|PACid:23159019 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10032748|PACid:23159019
Domain Number 1 Region: 433-535
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-23
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 2 Region: 215-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-20
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 3 Region: 34-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000153
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10032748|PACid:23159019
Sequence length 573
Sequence
MGPCYAVLEENEMENSRCPCFFETFSANLFSARLVGGLFLDHGWPTFVADHSLECGDLLV
FRYDGKFCFTVQVFDASKCEKEAAFQADCSRYRNSLHESTGKKRAREEDYAVSDKISKRR
KNNCSGENSECTERNESMEALAGMSDLVDILPKCGLVILGKASQKRNLADQTEQSWSRSS
NAASSSKFKSLHENPGYGSAFSEREKRVAESFISCYPYFVRIMKRFNINGSYTLNIPYKF
SMAHLPACKTEIVLGTVKGATFTVNSVPTTKVHTSHTLCGGWMAFVRSNDLKIGDVCIFE
LVRKYELRVFILRAGKDGPDNQSEILACNGVKVGCSATSQRIQSHRKKSRKPSSKVGTKL
IKHVELCEVGDSNKSQPAVLLDGSTKHSPATKISDSNFKTLGKGEYVEGDLHTKTGMGVK
MMLSLEEKAAKSFRSRFPHFVRIMRKFNVSGSYTLKIPHRFSTEYLPGFKTEIVLCNLRG
GRWPVNSLPDSKGRSVHTFCGGWMAFVRDNGVKLGNTCIFELVSSSEMRVHIHSNDGGEG
SENQSGNSAGNNEMPLVPFSSDDHHAILDEPFS
Download sequence
Identical sequences Lus10032748|PACid:23159019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]