SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10033902|PACid:23172873 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10033902|PACid:23172873
Domain Number 1 Region: 28-340
Classification Level Classification E-value
Superfamily SIS domain 7.34e-54
Family mono-SIS domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10033902|PACid:23172873
Sequence length 341
Sequence
MGSLPPSLDLPSPKHHHQIEESTLLSLFKSQQDHLNYFFRHLDLSQALSFTHTLLNHSSG
TVFFSGVGKSGFVANKISQTLVSLGIRASYLNPVDALHGDIGALSSLDVLVLFSKSGNTE
ELLRLVPCARAKGAYLVSVTSVEGNSLASVCDMNVHLPLERELCPFDLAPVTSTAIQMVF
GDTVAIALMGARNLTREQYATNHPAGRIGKSLIFKVRDVMKKQNELPICREGDLIMDQLV
ELTSKGCGCLLVIDPDYQLVGTFTDGDLRRTLKASGEGIFKLTVGEMCNRKPRTIGPDSM
AVEAMKKMESPPSPVQFLPVVNDQNVLIGIITLHGLVSAGL
Download sequence
Identical sequences Lus10033902|PACid:23172873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]