SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10035876|PACid:23141204 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10035876|PACid:23141204
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 8.11e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 144-218
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000000471
Family Middle domain of MutM-like DNA repair proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10035876|PACid:23141204
Sequence length 400
Sequence
MPELPEVEAARRALEEHCLGKKIIKAVVADDSKVIDGISPSDLQSALVGKTIVAALRKGK
NMWLKLDAPPFPSFQFGMTGAVYIKGVAVTESAVKDTDEWPSKFSKLFVELDNGVEFSFT
DKRRLAKIRLLNDPASVPPVSELGPDALLQPMTVDELHKALSKKKVGIKALLLDQARIHP
QQSSSSLSKECCETLHKCIKQVVEYAVEVDAVSSCFPLEWLFHYRWGKKPGKVIEQAIEV
GADSSQFPSNWLFHSRDKKPGKAFVDGKTIEFMTAGGRTTAYVPELQKLTGDQAGKERST
SKEKPLKRKKGKNDDIDEDGEMESGNEEEKASVKARPKREVKPRGGNAKETSEKNADDDD
DSDEDIDSSEDQNKKSGKTSNRKQRKAGKASKGKMKKSKK
Download sequence
Identical sequences Lus10035876|PACid:23141204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]