SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10037323|PACid:23152605 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10037323|PACid:23152605
Domain Number 1 Region: 189-287
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000216
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10037323|PACid:23152605
Sequence length 299
Sequence
MAEPEATVDGRRRPEGRLLFDSGTLRFSKFISRQTLNTSRLYTLVFQYDRAALFSVFIFD
ACGSEIEYPLLDVAAGVGKKLHTHSPEMPRKRSRSDSYSPKRHAMAATGGSTRTNDHGGS
SSRAPAESERLVSRSRGCNGKQLFREERSNVQETCAMAAALSSRWKDTSGNQWSKERSSW
KNSKPSKAKNPGFNVTLGKRSDFFLFLGTQTIPSSISELYMKQNPEILKLQVGSKSWRVK
ATKGNGHSYRMYGGWLDFARENSVKEGDICCFELMDKDDDIVLKVTICNTLLVAKKMLA
Download sequence
Identical sequences Lus10037323|PACid:23152605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]