SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10038802|PACid:23150693 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10038802|PACid:23150693
Domain Number 1 Region: 117-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000726
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10038802|PACid:23150693
Sequence length 256
Sequence
MAMLITLKDLKRKLDFTQMKNMDELDSLLKLTPIILTKLRQEDRKTTINEDHRQERNKIG
KGKRVRTNSSINNITIKKTIGRDYFVGDPEQLESRATIPKAFRECIERELQGREIKLIIQ
KHLFRTDLERSEGRFSIPQNKMCKGVLTKEEEEWLATARGEKNEVLGMELKMVDPELEVR
KMILKHWGMRKPNGRVSSMYLLAKYWNDVVKEHGFKEGEVVQLWGFRMGEELPGNLGLAL
VRLGMIETGASSGRGA
Download sequence
Identical sequences Lus10038802|PACid:23150693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]