SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10040319|PACid:23173840 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10040319|PACid:23173840
Domain Number 1 Region: 516-638
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.86e-19
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10040319|PACid:23173840
Sequence length 701
Sequence
MNSSSTYASSSSIDISSFSPSAMPTPGFSRPVKIIPLQHPSAAAAVAASSSPADFFSSFV
AKCKRLTFLQLIERLFPCCRWIRAYRWRDHFQVDLLAGLTIGIMLVPQAMSYAKLAGLEP
IYGLYTGFVPIFVYAIFGSSRQLAIGPVALVSLLVSNVLKGIAGSSDELYTELAIVLALM
VGILECIMGLLRLGWLLRFISHSVISGFTTASAVVIGLSQAKYFLGYNIIQSSKIVPLIK
SIIDGAGQFQWPPFVMGSGILAVLLIMKHLGKSRKQFKFLRAAGPLTGVILGATLAKIFH
QPSISLIGDIPQGLPSFSIPKNFGYAKSLIPTAFLITGVAILESVGIAKALAAKNGYELD
SSQELVGLGLANIFGSFFSAYPSTGSFSRSAVSNESGAKTGLSGVITGIVMCCALLFLTP
LFKSIPQCALAAIVVSAVIGLVEYEEAIFLWRVDKKDFVLWFITCTTTLFLGIEIGVLIG
VGVSLAFVIHESANPHIAVLGRLPGTTVYRNTQQYPEAYTYHGIVIVRVDAPIYFANTSY
IKDRLREYELKVDKSTRHGPEVERIHFVILEMSPVTYIDSSAIQALKDLYQEYKSRDIQI
AISNPNREVLLTLSKSGIVELIGKEWFFVRVHDAVQVCLRHVESLHQSPVIASDGTKPSL
YERLIKQNGISAADLETGQRTIASRNGDSRLEPLLSNKFST
Download sequence
Identical sequences Lus10040319|PACid:23173840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]