SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10040620|PACid:23157806 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10040620|PACid:23157806
Domain Number 1 Region: 62-189
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000126
Family BTB/POZ domain 0.019
Further Details:      
 
Domain Number 2 Region: 274-377
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000187
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10040620|PACid:23157806
Sequence length 590
Sequence
MANLSEPSSSLSFTSSSHLSNGSITHNNLPNSPVSEATPSLDVISLTKLSLNLESLLTDS
SIGDYSDAEIVVEGVSVGVHRCILAVRSKFFHELFKKGDNKGKDGKPKYIMKDMLPYGKI
GYEAFIIFLSYLYTGKLKPFPMEVSTCVHTPCAHDACRPAINFAVELMYASSIFQLPELV
SLFQRRLHNFVDKALVEDVVPILVAASHCQSAQLVAQCVDRVARSDVDNVCIEKELPYEV
AEKVKLVRRKPISSDDEESVDVADDPAREKQIKRIHRALDSDDVELVNLLLTESDVTLDD
AYAIHYAAAYCDPKVVQEVLNLRLADVNRRNSRDYTVLHIAAMRREPSVLVSLLEKGACA
SETTRDGQTAVSICRRSTRPKDYHSKTEQGQEANKDKICIEVLEREMRRNPMTQNITATP
HTPDEDLHMKLLYLENRVAFARLFFPTEAKLAMDIANADTTPEFAGLAASKGSSGNLREV
DLNETPVMQKRRLLVRLDALKKTVETGRRFFPNCSEVLDKFMEDDLPDVFFLEKGTPDEQ
RLKRNRYVELKDDVHKAFTKDKAVNRNVLSPSSSSAASQRDGGNKRLRKF
Download sequence
Identical sequences Lus10040620|PACid:23157806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]