SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10043234|PACid:23168140 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10043234|PACid:23168140
Domain Number 1 Region: 71-155
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000153
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10043234|PACid:23168140
Sequence length 182
Sequence
MEEDNKELSRAALQLIVLMYSKPERQKALPIPPDEKIPKLTREQHWRPPPIRPPAIPGLP
EFLIGECTEPYEKQLTESDVNPSQARLSLSKDYARDSILPLLNSTEDVVRGIRVTVYDAD
GKEFPMKLKLWAEKVYVLTSGWRPFAEAHRLVSHEDYVAVWVFRRLDTGSLCVAVTSRQL
PV
Download sequence
Identical sequences Lus10043234|PACid:23168140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]