SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488575686|ref|YP_007913333.1| from Hyphomicrobium denitrificans 1NES1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488575686|ref|YP_007913333.1|
Domain Number 1 Region: 6-384
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.5e-80
Family FMN-linked oxidoreductases 0.00000000388
Further Details:      
 
Domain Number 2 Region: 349-541
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.41e-27
Family N-terminal domain of adrenodoxin reductase-like 0.00000173
Further Details:      
 
Domain Number 3 Region: 490-682
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-24
Family C-terminal domain of adrenodoxin reductase-like 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488575686|ref|YP_007913333.1|
Sequence length 736
Comment NADH:flavin oxidoreductase/NADH oxidase [Hyphomicrobium denitrificans 1NES1]
Sequence
MARDPRFDILFTPLKLGSKTIRNRFYQVPHCNGAGTNSPGMNMAHRGIKAEGGWGAVNTE
QCSIHPECDDTLRITARIWDQGDMRNLRAMVDHVHSHGSLAGCELFYGGPHAPGIESRTI
SRGPSQYNSEFATVPGCPGFTYNHEADTDELHRLQQQYVDAALRARDTGFDLVNVYGAHA
YGPMQWLNPYYNRRTDKYGGSFENRARFWVETLEKIRRAVNDDVALVTRCATDTLYGTKG
VELTEDGLRFIELASPYLDLWDVNIGDIAEWGEDAGPSRFYPIAHENDWIRHIKQATSKP
VVGVGRYYDPEKMLQVVKAGIIDIIGAARPSIADPWLPRKIDEGRIDDIRTCIGCNVCIS
RWEMGGVPFICTQNATAGEEYRRGWHPEKFEPAKSEHDVLIVGAGPAGSECARVLMERGY
TVHLVDTREKTGGYVNDVATLPGLGEWSFHRDYRQTQLEKLIKKNPDCQIALKQKPMTAD
DVLQYGASRVVIATGAKWSTTGVNHRTHEPIPGADASLPHVLTPEQVFEGKKAVGKRVMI
INYDPYYMAPSLAEKFARAGHDVTVATVGGLGAYMEYTLEGANMQRLIHELGIKVLGEMG
CSRVEKGRVELFNIWGEGYKRSYKGAGQLPRNENSSHEWHECDTVILVTSRRSEDSLYRE
LKARKDEWAANGISNVFVIGDAESPRIIADATFDGHRLAREIEDPDPQHQKPYKREQRAW
GTAYNPNENPDLEWRV
Download sequence
Identical sequences N0B058
WP_015596871.1.29950 gi|488575686|ref|YP_007913333.1| gi|488577516|ref|YP_007915163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]