SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488576562|ref|YP_007914209.1| from Hyphomicrobium denitrificans 1NES1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488576562|ref|YP_007914209.1|
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily YccV-like 1.16e-31
Family YccV-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488576562|ref|YP_007914209.1|
Sequence length 110
Comment hemimethylated DNA binding protein [Hyphomicrobium denitrificans 1NES1]
Sequence
MDAIRHAKFAIGQVVRHRIYPFRGLIFDIDPEFANTEEWWLSIPEDVRPRKDQPYYHLYA
ENAETTYLAYVSEQNLLLDETSAPLRHPDISDRFISDESGIYRLRPRSAN
Download sequence
Identical sequences N0BC52
WP_015597745.1.29950 gi|488576562|ref|YP_007914209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]