SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|260891989|ref|YP_003238086.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|260891989|ref|YP_003238086.1|
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00448
Family Rubredoxin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260891989|ref|YP_003238086.1|
Sequence length 102
Comment hypothetical protein Adeg_0060 [Ammonifex degensii KC4]
Sequence
MGEEASLRCPFCGSFASEVSSLLPLPLRAGAAWLGWLHYLECPRCGRVGYREEELDRLNE
AIISHMTVSYFQKSGQEEGAGEQENLAGWLYRLKEPIATFGF
Download sequence
Identical sequences C9RAC7
429009.Adeg_0060 WP_012818216.1.101502 gi|260891989|ref|YP_003238086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]