SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260892248|ref|YP_003238345.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260892248|ref|YP_003238345.1|
Domain Number 1 Region: 194-704
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.19e-85
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000014
Further Details:      
 
Domain Number 2 Region: 4-126
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.77e-37
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0076
Further Details:      
 
Domain Number 3 Region: 141-237
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000837
Family Ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 4 Region: 756-802
Classification Level Classification E-value
Superfamily ADC-like 0.0000164
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260892248|ref|YP_003238345.1|
Sequence length 826
Comment NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein [Ammonifex degensii KC4]
Sequence
MAGMVTLTIDGRKVTVPEGTTILHAAEALGIEIPHLCYCPGLEGTGACRLCVVEVEKVRG
LVVACMRRVAEGMVVHTNTPRVREARKFVLELLLSRHPGLCLSCDKSGSCKLQQYAYELG
IKRPFFEVRDPGYEVKEDLFIVRDYNLCILCGRCIRVCRTQGADILDFMKRGIETRVGTP
LDRSLLESGCDFCGSCVSVCPTGALMEKERLGKGREWELEKVHSRCSYCGAACGLNYHLR
KGEIVKVSSPEPVAYLCARGRFGYGYLQSGERLTTPLVRRDGELVPADWDEALSLVAENF
QQAIERYGAEGVGGILSPLVSCETAYSFQKFFRSGLRTNNVDCSLRIGAGLELLRHADAV
TGGPEGYAGWKDVLEANVILLVGDVCQRVPAVWGYLKRAVGRGAKLIYLGFYKDRPARLA
QVWLQALPGEEPLVLARLAWLILQNPTYRTLAERVPNFTSFAEGVERLARVEVSVPEEDL
ARAAELWSEEARGVLLLPVDGVSPATGKAALNLLLLTGRREKALFPTSAFVNAQGVWRLG
GVAEFFPGLRPAPEAASEFAAFWGRVPNGTPGLNLTAMLRPGSPVKALYLLGEDPLSSYP
GNGSIAAKLEELDFLVVQDLTLTKTAEKAHVVLPLASLPETGGTVIATHGEKHHLSSALS
PRTLMPWQVFALLAAKMNLELNLSAQELLLNEIKAVTPEFGLVPAERRPGFWELGEVGPG
RGDSQLKLTTLAFYPSFYRQDWLKLSGLEVLLPYEGNFIALSPEEGLEEGAVVEVSTPHG
TFTTRVRLDKALPRGVAAVPAFSSAAAALFPLETPWEPVPASIARA
Download sequence
Identical sequences C9RB68
gi|260892248|ref|YP_003238345.1| WP_015738373.1.101502 429009.Adeg_0334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]