SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260892599|ref|YP_003238696.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|260892599|ref|YP_003238696.1|
Domain Number - Region: 13-76
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.068
Family YheA-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260892599|ref|YP_003238696.1|
Sequence length 197
Comment hypothetical protein Adeg_0699 [Ammonifex degensii KC4]
Sequence
MATVVDNRGRLVRVPSDRNLKRKIEKYARFQVKLRGVIPIGQYYHPREFRPYKEYYQYRL
WLEQQRVQQVREEVWAAKVEALVQKYVRARDSLERYQILLAAWSCGGKQAVEALANMVGA
CRKRAYKALLSYMRYRNYKRRLRDRVAVLVPPPAPNSARAIRVHEAGEVALESAGGGEVW
GQGRSGQTWDAKQRGSK
Download sequence
Identical sequences C9RC69
WP_015738724.1.101502 gi|260892599|ref|YP_003238696.1| 429009.Adeg_0699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]