SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260892849|ref|YP_003238946.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260892849|ref|YP_003238946.1|
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily RNase III domain-like 2.44e-53
Family RNase III catalytic domain-like 0.0000434
Further Details:      
 
Domain Number 2 Region: 111-224
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.97e-23
Family Double-stranded RNA-binding domain (dsRBD) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260892849|ref|YP_003238946.1|
Sequence length 235
Comment ribonuclease III [Ammonifex degensii KC4]
Sequence
MGLAKLKDKLGISWKEEKLLRLALTHPSYAYEHPGVEHNQRLEFLGDSVLSLVVSDYLYR
TFPEKSEGELTRLRAAVVCEASLARVAEELGIGEALLLGRGEEKSGGRKRPSLLADAFEA
LLGAIYLDQGLEVASAFALHLLRPVLQDVLEGRVERDYKTELQELLQKGSPEKIVYEVLQ
EEGPDHAKRFLVGVYYQGKCLGRGEGRSKKEAEQRAAREAWLKLSGGEEGSDGTF
Download sequence
Identical sequences C9RCW9
WP_015738973.1.101502 gi|260892849|ref|YP_003238946.1| 429009.Adeg_0961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]