SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260893355|ref|YP_003239452.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260893355|ref|YP_003239452.1|
Domain Number 1 Region: 82-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-29
Family Translational machinery components 0.00014
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.57e-22
Family Ribosomal S5 protein, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260893355|ref|YP_003239452.1|
Sequence length 173
Comment 30S ribosomal protein S5 [Ammonifex degensii KC4]
Sequence
MAQQEIDASKLELTERVVSIRRCAKVVKGGRRFTFSVLVIVGDGQGHVGAGLGKAAEVPE
AIRKGIEDAKKNLIKVPIVGTTIPHEVIGHYGAGKVLLKPAAPGTGVIAGGAVRAILELA
GIKDILTKSLGSNNPHNVTRATFDALMKLKDPAQVARLRGVKIDYRWASSGRE
Download sequence
Identical sequences C9R8H3
429009.Adeg_1507 WP_015739479.1.101502 gi|260893355|ref|YP_003239452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]