SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260893624|ref|YP_003239721.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260893624|ref|YP_003239721.1|
Domain Number 1 Region: 191-571
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 7.32e-139
Family Fe-only hydrogenase 0.00000000671
Further Details:      
 
Domain Number 2 Region: 77-217
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.18e-36
Family Ferredoxin domains from multidomain proteins 0.018
Further Details:      
 
Domain Number 3 Region: 4-76
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260893624|ref|YP_003239721.1|
Sequence length 583
Comment hydrogenase, Fe-only [Ammonifex degensii KC4]
Sequence
MADVCLTIDGFSVTVPEGTTILKAARQVGVKIPTLCYLEGINEVGACRICVVEVEGREEL
VTSCNTPVEEGMVVRTNTPAVREARRMTLELILANHPMECPTCPRNGNCELQNLAQQLNI
RTVRIPALPRKELPLDTSTVAIIRDPNKCIVCRRCESVCHNIQTVGAIALQGKGFAATVA
PVGGRYLDETNCVQCGQCALVCPVGAIYERDDTDKVWAALADPTKHVVVQTAPAVHVTIG
EMFGLPVGTDATGKIVAALRRLGFDAVFDTNFAADLTIMEEGTELLERIEKGGVLPQFTS
CSPGWIKFIEHFYPELLPHVSTCKSPQQMFGAIVKTYYAQLKGINPANIVSVSIMPCTAK
KFEAARPEMNASGYRDVDVVLTSRELGRMIKEAGIDFANLPDENYDDPFGIGTGAGQIFG
ATGGVMEAALRTAYELATGKTLPKLDFVEVRGMKGIKEASVELNGKTIKVLVAHGLGNAR
LLMEKLKAGELKDYHFIEVMTCPGGCIGGGGQPIPTTTEIREKRIAGIYERDKNLPYRKS
HENPAIKKLYEEFLGKPLSHKSHELLHTHYTPRLSWQALKAAK
Download sequence
Identical sequences C9R992
WP_015739748.1.101502 gi|260893624|ref|YP_003239721.1| 429009.Adeg_1783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]