SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260893592|ref|YP_003239689.1| from Ammonifex degensii KC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260893592|ref|YP_003239689.1|
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.08e-22
Family ABC transporter ATPase domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 369-432
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000196
Family Rad50 coiled-coil Zn hook 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260893592|ref|YP_003239689.1|
Sequence length 445
Comment SMC domain-containing protein [Ammonifex degensii KC4]
Sequence
MPKIRRIILENFQSHRYTEIELSPTVTVLVGESDRGKSAVVRALRWLFYNRPQGEGLVRA
GSHRCRVAVELEDGLLVEREREGKTNRYCIKYPDGKSLRLESPGRSVPKEVEELTGIKPY
SIGNQSLELHLAHQLDPPFLLRESPSVRAQVIGQIAGADLFQRAAKAALREQSQWQGRIK
SLEESVAALRKKISPLQEELPQLEEKLKTVRELVNGVLKAEERRAELLCLKEKRERLRRE
AAFFMSALARLPSEEILAAKLAELEELERRYGQLSKAAEARRRVSAALAREEEILRSLSR
LPFAEERGKELGRLGEKFAQLHRYREERQKRLDYSKKLELQVLSRLHRLAEAEEAFCRAD
AALRLYRELARCWREKKNRAGELEAEARKVRQQEEALNLEAERYRRALSSLQRCPLCGTD
LTPEHVEKVWRQELERMGIVLGEQL
Download sequence
Identical sequences C9R960
gi|260893592|ref|YP_003239689.1| WP_015739716.1.101502 429009.Adeg_1750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]