SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94967093|ref|YP_589141.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94967093|ref|YP_589141.1|
Domain Number 1 Region: 8-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-56
Family PP-loop ATPase 0.0000715
Further Details:      
 
Domain Number 2 Region: 343-455
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 219-309
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000191
Family MesJ substrate recognition domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94967093|ref|YP_589141.1|
Sequence length 464
Comment tRNA(Ile)-lysidine synthetase-like protein [Candidatus Koribacter versatilis Ellin345]
Sequence
MLPSLKSYIRTHALFRPGDRVGVAVSGGADSVALLRGLLELRSELGIALSVVHLHHGIRG
AEADADEQFVADLAGQFDLSLHLERVDVPSHSSQEKLSLETAARDLRYAFFRRLLESSAC
DKVATAHTLDDQAETVLLRILRGTGTRGLAAIPPFRDASPELAACIVRPLLGTERTEVET
YLKSLNQPWREDSTNTDPKHLRNRIRHELLPMLEAEYNPALRQSLANLAEIARAEEEYWG
PIVERHFDQIVTMTNFGAVLDRSRLSELPQAFRRRVLLALHDRLDMPVSFDGVDFELDFI
EGNQKGHITHAQASIQVTSDQVSFFLRDLTKDGPAAPVLFDQPLSIPTTLTLPTSTTLRT
TFIPASNAPRYNPHNLLAHDRLQLPLRVRNWQPGDRYWPAGSKQPEKLKRLFAEHHISAD
ARLTWPVVLSGETIVWVKDFPVAQGFQAEQQDAVLIEAVETRQV
Download sequence
Identical sequences Q1IVN3
204669.Acid345_0062 gi|94967093|ref|YP_589141.1| WP_011520869.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]