SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94968875|ref|YP_590923.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94968875|ref|YP_590923.1|
Domain Number 1 Region: 578-902
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.31e-121
Family Methionine synthase SAM-binding domain 0.0000000154
Further Details:      
 
Domain Number 2 Region: 28-301
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.57e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0021
Further Details:      
 
Domain Number 3 Region: 419-569
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.96e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000117
Further Details:      
 
Domain Number 4 Region: 322-409
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.7e-27
Family Methionine synthase domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94968875|ref|YP_590923.1|
Sequence length 909
Comment methionine synthase [Candidatus Koribacter versatilis Ellin345]
Sequence
MPDSETIAFKPLRLSGSQPFTQQQGVYMMIGERTNVAGSPKFAKLIKEGNYEAAVSIARQ
QVENGANVIDICMDEGMIDGVVAMARFLQYLTSEPEVAKVPFMVDSSKWEVIEAGLKGMQ
GKGIVNSISLKEGEDVFRQHAATILKYGAAAVVMAFDEQGQAAGYEDKIRICERAYRILV
DEVGFQPEDIIFDPNILTVATGMEEHNNYAVDYIRATRWIKANLPHAKVSGGVSNISFSF
RGNNKVREAIHSAFLYHAIAAGMDMGIVNAGMLEVYEEIEPELKVLVEDVLLNRRPDATE
RLVEHGEALKGVSTGTTAKKEEEWRNGTVEERLSHALVKGIDTYIEADTEEARAKLGRPL
LVIEGPLMDGMGVVGDLFGAGKMFLPQVVKSARVMKKAVAYLTPFMEAEKAALAASGQEV
KAQGKILLATVKGDVHDIGKNIVGVVLACNNYEVIDMGVMVPCEKILERAKAVNADLIGL
SGLITPSLDEMIHVAREMERNGFKTPLLIGGATTSRRHTAVKIAPHYSEPVVHVLDASRA
VPVATTLLSDEGKTAFVAQHRAEYESLRQAYAAPRLQVVSIEDARARRTPIAWRAEDISA
PSFTGVRVLQNVSLATLREFIDWSPLFHTWGLKGVYPRILDHAEIGPQARQIFQEANALL
DRIIEKNSISAHGVYGLFPANAVGDDVELYKDGKRADILTRFHFLRQQSDREGNDPCRSL
SDFVAPVETSLPDHIGAFAVTAGIGLKDLTEHFRADHDDYNAIMAEALADRLAEAFAEYL
HKQVRIAWGYGREEKLSNDELIHEKYRGIRPAPGYPACPDHTEKGTIWSLLDVEANTGMQ
ITESFAMWPGSSVSGLYFAHPESRYFSLGKIDRDQVADYADRKAMSVAEVERWLGQSLNY
TPASETIRA
Download sequence
Identical sequences Q1IQK1
WP_011522651.1.86553 gi|94968875|ref|YP_590923.1| 204669.Acid345_1848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]