SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94970453|ref|YP_592501.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94970453|ref|YP_592501.1|
Domain Number 1 Region: 3-371
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 3.92e-99
Family Homocysteine S-methyltransferase 0.00000223
Further Details:      
 
Domain Number 2 Region: 323-610
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.26e-71
Family Methylenetetrahydrofolate reductase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94970453|ref|YP_592501.1|
Sequence length 617
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Candidatus Koribacter versatilis Ellin345]
Sequence
MGKSFLERLGDGPILCDGAMGTLLYSKGIFINRCYDELNLSQPELIGGIHADYVANGAEI
LETNTFGANSFRLARHGCQEKLADINRAGVELVRKAIKNNQVYAAGAVGPLGIRIEPLGK
TSRDEARDAFRDQIRVLVDSGVDLLILETFGYLGELHQAILAARDVDPKIPVVAQVTIDE
DGNCLDGSSPEHYGARLTEWGADVIGCNCSVGPVAMLDALERLRAATPKPLSAQPNAGIP
RSVEGRNIYLCSPEYMASYARKFVGVGVTLVGGCCGTTPDHIRSMKSALRVGEARTTSFK
VKTEVEEHAVEPTPLGQRSRVGARIASGEFLTLVEIVPPKGVNAEKEVEGARYLMSVGVD
AINIPDSPRASARMSNQALCLLTQQQVGIETVLHYTCRDRNVLGIQSDLLGASAIGIRNL
ICITGDPPKMGNYPDATAVFDVDAIGLVNIVSNLNRGLDIGGNTIGTATQFTIAVGANPG
AANLDEEIRRFEYKVEAGAEYAVTQPVFDLALLEEFLKRIEHCRVPVVAGIWPLSSARNA
EFMRDELNISIPDAIYNRMARTTNADAARAEGVAVAREMLQAVRPMVQGTQLSAPFGRYS
AAADVLEVLGSSDSACA
Download sequence
Identical sequences Q1IL23
gi|94970453|ref|YP_592501.1| WP_011524226.1.86553 204669.Acid345_3426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]