SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971256|ref|YP_593304.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94971256|ref|YP_593304.1|
Domain Number - Region: 34-93
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00127
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94971256|ref|YP_593304.1|
Sequence length 252
Comment protein PASTA domain-containing protein [Candidatus Koribacter versatilis Ellin345]
Sequence
MRKFFSFVLRLLVLVVVFLVSMLTAMRFAIHTREVPIPKLVGMTPQQAQQTLTGLGLTLV
RENRYFSADVPEGKILSQMPPVGEKVRRGWRVRVAESMGPQRAIIPALLGDSQRAAELNI
RRRGLDLGTVAFINLPDSEPETVVAQDPPPNATGVTSPKISLLVAAPATPEAFVMPDFVG
QPLDSVVKTINDAGFKVGNIHTITPATPTATVAAPAPTPVPMSRSVATVVRQSPSPGQRI
TTDVAINVDVTR
Download sequence
Identical sequences Q1IIS0
204669.Acid345_4230 WP_011525029.1.86553 gi|94971256|ref|YP_593304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]