SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94968366|ref|YP_590414.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94968366|ref|YP_590414.1|
Domain Number 1 Region: 37-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.28e-67
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94968366|ref|YP_590414.1|
Sequence length 306
Comment L-proline dehydrogenase [Candidatus Koribacter versatilis Ellin345]
Sequence
MLRAVFIGLSENKSLRHFAESSAMGRRMSSRFAAGLEVKDAVAAAKKLNAMGATVSIDNL
GENVTNAAEARESAKLYHDMLDELSKDGLKANISLKLTHMGLDVDPALCHDLVSELVDHA
VKIDNFVRIDMEGSPYTQKTLDFVHELHRIPGHSGHVGAVIQSYMRRAEADVEKLLSERI
RIRLCKGAYKEPADIAFQQKSEVDANYVKLAKTLIKSGVYHGIATHDENIINELKQFAKA
ESIPASAFEFQMLYGVRRGLQEQLIKEGWGLRVYVPFGTEWYPYFMRRLAERPANALFIA
KNMFRN
Download sequence
Identical sequences Q1IS10
204669.Acid345_1338 gi|94968366|ref|YP_590414.1| WP_011522142.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]