SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336124626|ref|YP_004566674.1| from Vibrio anguillarum 775

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336124626|ref|YP_004566674.1|
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.7e-55
Family Molybdopterin synthase subunit MoaE 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336124626|ref|YP_004566674.1|
Sequence length 157
Comment molybdopterin converting factor, large subunit [Vibrio anguillarum 775]
Sequence
MMDSRISVQISDFSVDAEYRDLSQGTSAGAVVTFIGKVRDMNLGDNVIGLTLEHYPGMTE
KALSDICDQAQARWPVQKIRVIHRIGDLDIGDQIVFVGVSSSHRGAAFEACEFVMDYLKA
KAPFWKKERTTEQTRWVESRDSDAQAAQRWANHHTID
Download sequence
Identical sequences A0A233HC69 A0A233IML3 A0A241PDS7 F7YLZ3
gi|336124626|ref|YP_004566674.1| WP_013857258.1.102100 WP_013857258.1.14067 WP_013857258.1.1602 WP_013857258.1.1920 WP_013857258.1.20930 WP_013857258.1.22219 WP_013857258.1.23305 WP_013857258.1.23371 WP_013857258.1.29031 WP_013857258.1.29555 WP_013857258.1.29797 WP_013857258.1.29879 WP_013857258.1.29907 WP_013857258.1.34300 WP_013857258.1.35475 WP_013857258.1.36349 WP_013857258.1.3648 WP_013857258.1.41996 WP_013857258.1.46886 WP_013857258.1.52133 WP_013857258.1.55957 WP_013857258.1.70040 WP_013857258.1.77604 WP_013857258.1.82469 WP_013857258.1.84384 WP_013857258.1.85197 WP_013857258.1.96173 WP_013857258.1.99586 gi|537454638|ref|YP_008488490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]