SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336125862|ref|YP_004577818.1| from Vibrio anguillarum 775

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336125862|ref|YP_004577818.1|
Domain Number 1 Region: 576-1036
Classification Level Classification E-value
Superfamily ALDH-like 8.38e-126
Family ALDH-like 0.000000518
Further Details:      
 
Domain Number 2 Region: 190-530
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-113
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000372
Further Details:      
 
Domain Number 3 Region: 17-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.92e-62
Family N-terminal domain of bifunctional PutA protein 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336125862|ref|YP_004577818.1|
Sequence length 1040
Comment Proline dehydrogenase [Vibrio anguillarum 775]
Sequence
MFTATDVLNAEFIEQPLDKLWSLISPLYMVDESQWLKQLLPLATATESEKSAILNKTTQL
IEAIRADKKAVQMIDALLLEYSLDTQEGILLMCLAEALMRIPDAETADAFIKDRLSVADW
KSHLKNSDSVFVNASTWGLMLTGKVIGLADVDTTSPTQAVNRLVNKLSEPVIRKAMHQAM
KVMGHQFVLGRTIEEAQKNGRPMRDKGYTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
REKYGLSTSPAPSVSIKLSALHPRYEVANQERVLSELYSTLLQLLARAIELDVAITIDAE
EADRLELSLKLFEKIYRSEPVKGWGKFGLVVQAYSKRALPVLVWLNGLAKQQGDVIPLRL
VKGAYWDSEVKWSQQSGYSNYPVYTRKEATDVAYLACARFLLSEGVRGHIFPQFASHNAQ
TVTAIAVMSQHKDFEFQRLHGMGDALYHHAMKAYQQSVRIYAPVGSHKDLLPYLVRRLLE
NGANSSFVHRLVDARCPIDTLTQHPVDMLLSFDSLPNTKIPLPPHIFAERVNSYGVNIDI
ESEATPFEAKVECWLSKQWHASPIINGVALLESMIKAGASPEVVTAPYDRRKHVGQVVFA
NLDHVSEAISIAEQSFAAWKQEEHSVRAGKLDKLADLLEENLAELVAICHHEAGKTIHDS
IDEVREAVDFCRYYAKQVSALTPFEVTSFDNEKRKVSREGRGVFVCISPWNFPLAIFLGQ
ITAALVAGNTVVAKPAEQTSLIASRAVELMLEAGFPAGVIQLLPGRGAEIGSALTSHPAI
AGVAFTGSTATAQRINQSLAQRDAAPVPLIAETGGQNAMIVDSTALPEQVVRDVIRSAFA
SAGQRCSALRVLFVQQDIADRIISLIHGAMNELKIGIPYLHSTDVGPVIDGKAKQKLLSH
IEQMTKTQTKVAQLELSAECQHGDFVPPAAFEISDIHCLTEEQFGPILHIVRFKARELAD
VVQQINQTGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGT
GPKAGGPHYLYRFTQTEFSQ
Download sequence
Identical sequences A0A241NMS6 F7YSX6
gi|336125862|ref|YP_004577818.1| gi|537457024|ref|YP_008489672.1| WP_013868198.1.23305 WP_013868198.1.23371 WP_013868198.1.46886 WP_013868198.1.55957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]