SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for est_fge1_pm_C_130121.1 from Aspergillus niger ATCC 1015

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  est_fge1_pm_C_130121.1
Domain Number 1 Region: 199-595
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.91e-131
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.000000000715
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.45e-65
Family Inosicase 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) est_fge1_pm_C_130121.1
Sequence length 595
Comment | est_fge1_pm_C_130121 | Aspergillus niger est_fge1_pm_C_130121 (596 aa)
Sequence
MSQQKSAILSVYDKTGLLDLAKGLVKHNVRLLASGGTARLIREAGFPVEDVSAITHAPEM
LGGRVKTLHPAVHGGILARDIESDEKDLADQNIAKVDFVVCNLYPFKETVNKVNVTIEEA
VEEIDIGGVTLLRAAAKNHSRVTILSDPQDYPEFLKELEAGEITDASRKSYALKAFEHTA
DYDTAISGFFRKQYAGNGEQYMALRYGTNPHQKPASAFMTQGKLPFKALNGAPGYVNLLD
ALNAWALVKELKQALGLPAAASFKHVSPAGAAVGVPLTEKERKVYMVDDIAGIESSGLAQ
AYARARGADRMSSFGDILALSDVVDVPTAKIVSREVSDGVIAAGYTPEALQILSKKKGGK
YLVLQMDENYVPAAEETRTLYGVQLTQHRNDIVITPQKTFNTVITPKDLKSLPESALRDL
TVATIALKYTQSNSVCYALNGQVIGLGAGQQSRIHCTRLAGDKADNWWMRFHDRVLNIKW
KQGTKRPDKSNAIDLLCSGQTPRTEAEKAEYERVFEEVPAPFTQEERDAWLQNLGEVAVS
SDAFFPFIDNVFRAARSGVKYIAAPSGSQNDSAVFETSEKLGIVFVEQGTRLFHH
Download sequence
Identical sequences A0A254TTU0 G3Y8M8
est_fge1_pm_C_130121.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]