SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gw1_2.1986.1 from Aspergillus niger ATCC 1015

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gw1_2.1986.1
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.08e-20
Family Deoxycytidylate deaminase-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gw1_2.1986.1
Sequence length 220
Comment | gw1_2.1986 | Aspergillus niger gw1_2.1986 (220 aa)
Sequence
TPHLHYMTQCLALARKAPALPTNFRVGALLLSRSTTDTTPTYSSDILLSTGYTMELAGNT
HAEQCCLSNYASVHGVPDEQVHTVLPHNDPERKLVMYVTMEPCGKRLSGNAPCVERIINT
RQGGEGRGIQKVYFGVKEPGTFVGESEGVRRLEEAGVEWEVVPGLEREILEVAVEGHEKE
KREEEVRSALEGVKTDVEPSEEERRRQETQPRNPKKRMME
Download sequence
Identical sequences gw1_2.1986.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]