SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gw1_5.268.1 from Aspergillus niger ATCC 1015

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gw1_5.268.1
Domain Number 1 Region: 182-229,277-307,386-420
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000000000000317
Family Deoxycytidylate deaminase-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gw1_5.268.1
Sequence length 506
Comment | gw1_5.268 | Aspergillus niger gw1_5.268 (506 aa)
Sequence
MDVEEILRGIEPLEGQVTAIRTVQETRPREDYADAYITEVNVKCASKVIKVLDSRFPRDS
SQPLSHLRRFAKHNQLPEHLRPILLHEGSSPAQTIFVLVSPPLPDLESLQDALSPFAPPN
PAGEENSNNPLTFHTIRIPLQPPLTPVQADAWSKSMWPVVYNPAAPRAMIAPPPHILARA
RDSIQPKAGRYLALAQRVADEAERSGLGRRVGAVVVDPDLEATIAEQAATDDNDNDNDNG
IHWSDAVVAVAGDGRYSRADTGTEPPNPPNQYATTYSPDHEGGPELHALMRAVELIASKR
REDRPGSSATNRPCLTDVERYFLSKSDTDITAAQPTEPEPESKESTPVPPPEKYQKTTET
TAHPIHTSTSTGTSTSRIRPRSQGGYLCTDLDVYLTHEPCICCSMGLLLSRFRAVVFPRS
GRMVSGGLASEPVVRPVPAEEDENENENENENGIGAEKTDDDGSVEREYYGLHWRKELNW
RALGFEFVEELENEEGSAELGVAFHA
Download sequence
Identical sequences A0A2K5A5S1 G3XZN2
gw1_5.268.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]