SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|37654 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|37654
Domain Number 1 Region: 36-236
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.03e-33
Family Ribosomal protein L1 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|37654
Sequence length 332
Sequence
MVASPLVASDVTKAVKALLAYRSKQGRGLDLDADFLTVQIGLKQAPITPSPKPRLVALPH
PLKDASELSCCLIVKAADKPWLKALAVDGEAPGPKLVDKVLAFDKLRSSYKQYKDKRELR
DRFDVFLADDRVAPMLGKLLGSTFFGRKKQPIVVKVTRPESLAAQIRKATASAHVVLKEG
TCVAANLAHTDMSADECVANVVAGVNAVVGDLVPKKWNNVLSVSLKLPESAALPLYNADP
TAGAGLPDAPPAATAPAKRADTPAAPAKKPAKKDAAAPPPAPKRARDDAKPAAAEKKAKK
PKAAPKVVAAAPAAKRAPSLKDKLKARKAMKC
Download sequence
Identical sequences F0YAN1
XP_009037332.1.21850 jgi|Auran1|37654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]