SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|58684 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|58684
Domain Number 1 Region: 108-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.8e-71
Family G proteins 0.00000205
Further Details:      
 
Domain Number 2 Region: 679-855
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-51
Family Translational machinery components 0.0000237
Further Details:      
 
Domain Number 3 Region: 458-584
Classification Level Classification E-value
Superfamily Translation proteins 6.19e-28
Family Elongation factors 0.0012
Further Details:      
 
Domain Number 4 Region: 856-943
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-26
Family EF-G/eEF-2 domains III and V 0.00026
Further Details:      
 
Domain Number 5 Region: 606-677
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.24e-16
Family EF-G/eEF-2 domains III and V 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|58684
Sequence length 998
Sequence
MMEYDEFGNLIGGDSDDESEGEAAPAAYGDASAGDGQVVAMEEDEVGERAVVLHEDKQYY
PDAADVYPGARTVVLDEDAQPLEEPILKPAAVRLFSTLDHSAPGEKSYTVDFMRGLMERP
ELIRNVALLGNLHCGKTTLTDVFVQHAHRVEWDPSKEFKFSDTRKDEQERQLSIKCAPVS
MVLPDSRGKHYMVHLVDCPGHVGFNDEVTAALRAVDGAVIVVDAVEGVMASTERLIKHAI
EARVGLTLVINKVDRLILELKLPPTDAYFKLVHTVDDVNACVAECWGAARDRLRLGDEQP
PRLSPTKGDVCFASAQHCWCFTLESFARVYGEDAARKGSGGVDAKALGKRLWGDVYFDSS
TRKFGRAPPPPTGAKQKRCQRSFVEFVLEPLYKIYAHVLGEEPGSLNAALGAVGIKLAVD
ELSLDPKPLLKCALRRFFKGRATAAFVDVISRHSPSPKAHSATKVAYHYCGALDGDRAAA
MAGCADDGPLCVNVVKLFSTPDATGFVAFGRVYSGRVAPGARVNVLGENYSPDDPEDARP
CVVAGVSVCHGRHATDVPSAGPGNLVLLEGVDASIAKTATIVDAAGGSDADPVHIFRPLK
FDNLAVVKLAVEPLNPSELPKMTEGLRKISKSYPLAQTKVEESGEHVVLGTGELYLDCVM
HDLREMYGAVEVKVADPVVAFCETVIETSSLKCFSETPNKRNKLTMIAEPLDAGVADAAE
RGDVDHRWSKKQVGQYFQKTYDWDLLAARSIWAFGPDALGSSSFGGGCSNVLLDDTLPSE
VDKRLLNAAKESVVQGFQWGCREGPLCDEPIRNVKFKILDASISDVALHRGGGQVIPTAR
RVCYSAFLMACPRLMEPIFAVDVQCPADCVAAVYPVLARRRGHIVQDAPKPGAPFYTVKA
YIPAVDSFGFETDLRAFTQGQAMCSQVFDHWAVCPGDPLDRSIILHPLEPSPPPHLAREF
MVKTRRRKGLSEDVSIAKFFDDPMLKELSEMQPGGGGM
Download sequence
Identical sequences F0Y0W1
XP_009033668.1.21850 jgi|Auran1|58684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]