SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442314170|ref|YP_007355473.1| from Riemerella anatipestifer RA-CH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442314170|ref|YP_007355473.1|
Domain Number 1 Region: 19-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.74e-34
Family Phosphate binding protein-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|442314170|ref|YP_007355473.1|
Sequence length 288
Comment Accessory colonization factor AcfC, contains ABC-type periplasmic domain [Riemerella anatipestifer RA-CH-2]
Sequence
MKQWFLFIYLVICVRVMAQADTLYVYGPGGPYAPINEAAQIFAKRNNLNIKVTKGPFSQW
KDKARNNAHLIYSGAEFMMTQFISELGNVQEQTVYPLYLRKSGLIVRKGNPKNIKTLKDL
MKSELRIMVVNGAGLTGVWEDIAGKTQDIEVLRKIRKNIVLFAENSGQAQSFWAKDPSID
VWISWNIWQKNNTGSADFVSLEDRYTTYRDCGIALTAYGEANPKALEFYQFLKGKEVQAL
FEKQGWIERNPSAQKKKEDRKPQKVYSRKEKLSSLKQKKEGLLINHQS
Download sequence
Identical sequences A0A161P9L7
WP_004920525.1.21683 WP_004920525.1.27570 WP_004920525.1.34653 WP_004920525.1.34861 WP_004920525.1.3884 WP_004920525.1.49580 WP_004920525.1.51207 WP_004920525.1.5278 WP_004920525.1.5491 WP_004920525.1.55645 WP_004920525.1.6213 WP_004920525.1.72231 WP_004920525.1.73884 WP_004920525.1.78695 WP_004920525.1.8112 WP_004920525.1.82490 WP_004920525.1.90512 WP_004920525.1.9884 gi|442314170|ref|YP_007355473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]