SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ACLA_015870 from Aspergillus clavatus NRRL 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ACLA_015870
Domain Number 1 Region: 15-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000328
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 74-111
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000811
Family Zn2/Cys6 DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ACLA_015870
Sequence length 426
Comment | Aspergillus clavatus null (427 aa)
Sequence
MNRTTNPTSATKALFHCPHPGCGRSYQRKEHLTRHFASHGQAPACECPFCDKVFSRNDTL
RQHVRIHHKDKELKSTRTIRACSHCRARRSRCDGRVPCKACTQRGIQCSLGQSSAAAAHA
HQGTGTPRDSRTDLTVSDSQDEQPGPSDRSITPEQRAEGPLLVRKAAILHYVEVYFERFH
PVWPFLHRATFDPDLEPPILLQSVIMMGLWMAGEEDTQCKALKLHEKLSLLVYQQRDNWA
GSDLNYENPPPWPMATYQGILLQIIFALIKDNETQLDIQLTRPLCRGSSRLLTTLIDTCR
RQNLFFYPAILAQFSRESVPDVFIWVGIEEVKRFALALYKVCRLCHVQDTELDTPRSTGR
GKDLLALMDLQFALPDSDELWHASSDLAARLAQDGPMCYSNKNIEANWISQAARLLQKQG
LAFDWL
Download sequence
Identical sequences A1CBM3
XP_001274567.1.35617 5057.CADACLAP00001223 ACLA_015870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]