SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AO090001000350 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090001000350
Domain Number 1 Region: 209-275,350-422
Classification Level Classification E-value
Superfamily E set domains 0.00000000606
Family Arrestin/Vps26-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AO090001000350
Sequence length 815
Comment | Aspergillus oryzae Unknown (816 aa)
Sequence
MTTAHITPLQQDLSVTTTSPVVQLHCSPPESLSSGHTSPSAEHRRSVDPSAVVGANFPKQ
TNRRASIFRKLAGPRENAKRFLRLGGSVRAQSPPSIRSMSRTQRPRPVSEIVLSPEDARM
LASTSLGAGLGTGRMRSHSSSTGSVNQSSAGSVTSAPSSDSMGPFPTLRHEKIVATGSGI
TVGIALTEPVLYLQGYDHNDPSTKKFAILRGQLHLKVTKSVKIKKISICFRGHAQTDWPE
GIPPKKVHYHDKKDLVTHGMMYFNHGDSVLPQNDYGANFYQHAKPVASVTGKDGSPVTIT
REIFSKSGSSTSLGNGHPTSKELKRLSLQSNHSRSFGKNDPPPSVVAHPQRNYRMFPVGD
YLYNFEFTIDGSLPETIKTDLGYVRYDLEAIVERSGAFRPNLLGNLEVPVIRTPAEGSLE
QVEPIAISRNWEDQLHYDIVISGKSFPLGSQVPIAFKLTPLAKVECHRIKVYVTENIQHW
TADKSVHRFQPAKKVLLFEKRADSASTSTYPGSSMRVTAGGGIDWDHRAAAARGDEIVDR
NRTNLLGNLASDSGVGPTEMEFNVQLPSCHEMKNRDESHKLHFDTTYENIQINHWIKIVL
RLSKVDERDPTKRRHFEISIDSPFHLLSCKATQANIYLPAYTSPNSDPAPPAQEYECGCP
GAAALNRASSNGHSPCSEAEEPPTRAVNRSFTNGSGGLARPPQAHLAHEPSDRADEPPPR
PMHLLRAPSFAPPAFEDVPPPPPLITPPPEYTSIVGNNDRETVLEDYFSRLSCYEETADD
PRGLGRVDVPLTPGGRVNRSMDVPREWVRLDQSTV
Download sequence
Identical sequences Q2UNI7
5062.CADAORAP00000312 AO090001000350 XP_001818880.1.101437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]