SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AO090011000067 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090011000067
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily CutC-like 1.44e-29
Family CutC-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AO090011000067
Sequence length 190
Comment | Aspergillus oryzae Unknown (191 aa)
Sequence
MIRPHAESFYYSDTDFEAMKRTMHSLREKGADGFVFGILTQNTPAQAAPRIDVARNKELV
ELAQGRPCTFHRAFDLISESNWDTALAGIVECGFTSILTSGPSGGTAIECVDHLDRLVHE
RLEQLRGRVEGHARLPQIIVGGGVRATNIGMLWERTRAPAFHSAALAQSSVELVSDAEVE
ALRAALNKAT
Download sequence
Identical sequences Q2U1E0
5062.CADAORAP00004783 AO090011000067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]