SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AO090120000378 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090120000378
Domain Number 1 Region: 175-249
Classification Level Classification E-value
Superfamily E set domains 0.00000483
Family Arrestin/Vps26-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AO090120000378
Sequence length 535
Comment | Aspergillus oryzae Unknown (536 aa)
Sequence
MPGRLLSSLVRPHVHHHTSFSSHSTSSSSTSVNEIHTHTVAHKKPSANVLERARSPERRL
SFAVDHLIHPHRDHSKEKRRSHGRSSGSKERPGDHGVSATAKLDVVVESPPLVCYGSPAN
STGALFSGRLKITVSEAVDSITLDKFDMRLMTRMTTKKPVSRECPNCASRTEELNHWNFL
TEPLHLKPGDHEFPFSYLFPGHLPASCNGSLGKIEYYLSAHAQNTTGEEYDFQMPLHIRR
AILPGNDKSSIRIFPPTNLTGRIVLPSVVHPIGTFPVQMTLSGVVDKGEETQTRWRLRKM
MWRIEEHQKIVSTACGKHAHKIGGEGKGVLHQETRIIGHNEEKEGWKTDFDTAGGEISMQ
FEASINPTCNPVCDLEASGGLEAKHNLVIELIVAEEFCPNRNTRLITPTGAARVLRMQFH
LHVTERSGLGISWDEEMPPMYEDVPASPPGYTNPDASSVMEDYHGSPLPLPEYEDLERMD
SLRLDSDSTHSSARSILSTRGRSRFTTDDLTAEPMTQQNRNRAPSADSQVSRASE
Download sequence
Identical sequences A0A0D9N0T4 B8NKV5 I8AA42 Q2U651
XP_001824097.1.101437 XP_002381179.1.25037 5059.CADAFLAP00009044 5062.CADAORAP00011279 AFL2T_08382 AO090120000378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]