SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76786820|ref|YP_329772.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76786820|ref|YP_329772.1|
Domain Number 1 Region: 10-259
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.13e-61
Family LplA-like 0.000000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76786820|ref|YP_329772.1|
Sequence length 277
Comment hypothetical protein SAK_1151 [Streptococcus agalactiae A909]
Sequence
MEWQDLAQLPVSIFKDYVTDSQDAEKPFIWTEVFLREINRSNQEIILHIWPMTKTVILGM
LDRELPHLELAKKEIISRGYEPVVRNFGGLAVVADEGILNFSLVIPDVFEKKLSISDGYL
IMVDFIRSIFSDFYQPIEHFEVETSYCPGKFDLSINGKKFAGLAQRRIKNGIAVSIYLSV
CGDQKERSRMISDFYKIGLGDTGSPIAYPNVDSEIMANLSDLLDCPMTVEDVIDRMLISL
KQVGFNDRLLMIRPDLVAEFDRFQAKSMANKGDGEQR
Download sequence
Identical sequences A0A2I2AHY0
gi|406709519|ref|YP_006764245.1| gi|76786820|ref|YP_329772.1| 205921.SAK_1151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]