SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76786925|ref|YP_328992.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76786925|ref|YP_328992.1|
Domain Number 1 Region: 6-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.46e-128
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76786925|ref|YP_328992.1|
Sequence length 304
Comment glycyl-tRNA synthetase subunit alpha [Streptococcus agalactiae A909]
Sequence
MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLRAIGPEPWNAAYVEPS
RRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLKSLELLGINPLEHDIRFVEDNWE
NPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLQTGPVTSEVTYGLERLASYIQEVDSVYD
IEWAPGVKYGEIFTQPEYEHSKYSFEISDQVMLLENFEKFEREAKRALEEGLVHPAYDYV
LKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVAERKKLGFPLLDEETRIKLL
AEED
Download sequence
Identical sequences A0A1F0CAQ1 A0A1J7X6I6 F8XYC1 Q3K3B1 Q8E1T5 S8FM95 S8G0X6 S8GKC3 S8H1L8 S8HLC7 S8NGT7 S8P5R9 S8P8I4 S9AW71 S9BAQ2 S9CEB3 S9D391 S9L5V9 X5JZB8
205921.SAK_0340 208435.SAG0268 gi|22536452|ref|NP_687303.1| gi|512697687|ref|YP_008116972.1| gi|512538508|ref|YP_008084012.1| gi|406708791|ref|YP_006763517.1| gi|76786925|ref|YP_328992.1| gi|512543978|ref|YP_008086091.1| NP_687303.1.71890 WP_000038755.1.100037 WP_000038755.1.100058 WP_000038755.1.100254 WP_000038755.1.10029 WP_000038755.1.100355 WP_000038755.1.100367 WP_000038755.1.100766 WP_000038755.1.100991 WP_000038755.1.101195 WP_000038755.1.101208 WP_000038755.1.101222 WP_000038755.1.101267 WP_000038755.1.101283 WP_000038755.1.101296 WP_000038755.1.101328 WP_000038755.1.101830 WP_000038755.1.101853 WP_000038755.1.101864 WP_000038755.1.101938 WP_000038755.1.101956 WP_000038755.1.10297 WP_000038755.1.10371 WP_000038755.1.10618 WP_000038755.1.10620 WP_000038755.1.1067 WP_000038755.1.10676 WP_000038755.1.10723 WP_000038755.1.10924 WP_000038755.1.11248 WP_000038755.1.11343 WP_000038755.1.11465 WP_000038755.1.11756 WP_000038755.1.11774 WP_000038755.1.12072 WP_000038755.1.12166 WP_000038755.1.12215 WP_000038755.1.12249 WP_000038755.1.12331 WP_000038755.1.12363 WP_000038755.1.1251 WP_000038755.1.12619 WP_000038755.1.12688 WP_000038755.1.12755 WP_000038755.1.1293 WP_000038755.1.12978 WP_000038755.1.13008 WP_000038755.1.13064 WP_000038755.1.13167 WP_000038755.1.13285 WP_000038755.1.13384 WP_000038755.1.13493 WP_000038755.1.13553 WP_000038755.1.13737 WP_000038755.1.13885 WP_000038755.1.1402 WP_000038755.1.14040 WP_000038755.1.14140 WP_000038755.1.14275 WP_000038755.1.14324 WP_000038755.1.14368 WP_000038755.1.1437 WP_000038755.1.14429 WP_000038755.1.14563 WP_000038755.1.14738 WP_000038755.1.14953 WP_000038755.1.14960 WP_000038755.1.15385 WP_000038755.1.15417 WP_000038755.1.15526 WP_000038755.1.15556 WP_000038755.1.16134 WP_000038755.1.16165 WP_000038755.1.1633 WP_000038755.1.16335 WP_000038755.1.16342 WP_000038755.1.16535 WP_000038755.1.16580 WP_000038755.1.16595 WP_000038755.1.16706 WP_000038755.1.16976 WP_000038755.1.17074 WP_000038755.1.17243 WP_000038755.1.17339 WP_000038755.1.17380 WP_000038755.1.17489 WP_000038755.1.17506 WP_000038755.1.1760 WP_000038755.1.17709 WP_000038755.1.1775 WP_000038755.1.18003 WP_000038755.1.18047 WP_000038755.1.18263 WP_000038755.1.18362 WP_000038755.1.18425 WP_000038755.1.18450 WP_000038755.1.18747 WP_000038755.1.1882 WP_000038755.1.18829 WP_000038755.1.18841 WP_000038755.1.18933 WP_000038755.1.19073 WP_000038755.1.19086 WP_000038755.1.19604 WP_000038755.1.19892 WP_000038755.1.19950 WP_000038755.1.20123 WP_000038755.1.20188 WP_000038755.1.20258 WP_000038755.1.20326 WP_000038755.1.20350 WP_000038755.1.20458 WP_000038755.1.20511 WP_000038755.1.20717 WP_000038755.1.20726 WP_000038755.1.20791 WP_000038755.1.20847 WP_000038755.1.21087 WP_000038755.1.21280 WP_000038755.1.21522 WP_000038755.1.21525 WP_000038755.1.21669 WP_000038755.1.21722 WP_000038755.1.21779 WP_000038755.1.21860 WP_000038755.1.2195 WP_000038755.1.22004 WP_000038755.1.22076 WP_000038755.1.22087 WP_000038755.1.22139 WP_000038755.1.222 WP_000038755.1.22247 WP_000038755.1.22552 WP_000038755.1.22749 WP_000038755.1.22801 WP_000038755.1.23380 WP_000038755.1.23384 WP_000038755.1.23508 WP_000038755.1.24296 WP_000038755.1.24441 WP_000038755.1.24475 WP_000038755.1.24559 WP_000038755.1.24827 WP_000038755.1.24845 WP_000038755.1.25002 WP_000038755.1.2509 WP_000038755.1.25303 WP_000038755.1.2555 WP_000038755.1.25670 WP_000038755.1.25781 WP_000038755.1.25973 WP_000038755.1.25985 WP_000038755.1.25998 WP_000038755.1.26029 WP_000038755.1.26056 WP_000038755.1.26153 WP_000038755.1.26174 WP_000038755.1.26258 WP_000038755.1.26300 WP_000038755.1.26312 WP_000038755.1.26357 WP_000038755.1.26386 WP_000038755.1.2651 WP_000038755.1.26791 WP_000038755.1.26827 WP_000038755.1.27024 WP_000038755.1.27325 WP_000038755.1.2754 WP_000038755.1.27583 WP_000038755.1.27751 WP_000038755.1.2781 WP_000038755.1.27880 WP_000038755.1.27958 WP_000038755.1.28021 WP_000038755.1.28197 WP_000038755.1.28342 WP_000038755.1.2844 WP_000038755.1.28613 WP_000038755.1.28624 WP_000038755.1.28738 WP_000038755.1.28991 WP_000038755.1.29020 WP_000038755.1.29163 WP_000038755.1.29238 WP_000038755.1.29352 WP_000038755.1.29410 WP_000038755.1.29470 WP_000038755.1.29532 WP_000038755.1.29719 WP_000038755.1.29888 WP_000038755.1.30062 WP_000038755.1.30182 WP_000038755.1.30200 WP_000038755.1.30252 WP_000038755.1.30310 WP_000038755.1.30450 WP_000038755.1.30603 WP_000038755.1.30703 WP_000038755.1.30710 WP_000038755.1.3074 WP_000038755.1.30831 WP_000038755.1.30974 WP_000038755.1.31109 WP_000038755.1.3166 WP_000038755.1.31888 WP_000038755.1.31896 WP_000038755.1.32511 WP_000038755.1.32520 WP_000038755.1.32603 WP_000038755.1.32728 WP_000038755.1.32745 WP_000038755.1.32818 WP_000038755.1.33723 WP_000038755.1.34227 WP_000038755.1.34276 WP_000038755.1.34467 WP_000038755.1.34475 WP_000038755.1.34828 WP_000038755.1.34896 WP_000038755.1.34906 WP_000038755.1.34981 WP_000038755.1.35216 WP_000038755.1.35399 WP_000038755.1.35428 WP_000038755.1.35443 WP_000038755.1.35621 WP_000038755.1.35908 WP_000038755.1.35937 WP_000038755.1.36095 WP_000038755.1.36202 WP_000038755.1.36258 WP_000038755.1.36403 WP_000038755.1.36408 WP_000038755.1.3658 WP_000038755.1.36776 WP_000038755.1.36800 WP_000038755.1.36878 WP_000038755.1.3691 WP_000038755.1.36977 WP_000038755.1.37018 WP_000038755.1.37098 WP_000038755.1.37124 WP_000038755.1.37523 WP_000038755.1.37570 WP_000038755.1.37692 WP_000038755.1.3814 WP_000038755.1.38237 WP_000038755.1.3845 WP_000038755.1.38456 WP_000038755.1.38578 WP_000038755.1.38699 WP_000038755.1.3880 WP_000038755.1.38842 WP_000038755.1.38910 WP_000038755.1.3927 WP_000038755.1.3930 WP_000038755.1.3937 WP_000038755.1.39381 WP_000038755.1.39386 WP_000038755.1.39495 WP_000038755.1.3963 WP_000038755.1.40015 WP_000038755.1.40055 WP_000038755.1.40203 WP_000038755.1.40241 WP_000038755.1.40359 WP_000038755.1.40538 WP_000038755.1.40694 WP_000038755.1.40765 WP_000038755.1.40812 WP_000038755.1.41269 WP_000038755.1.41338 WP_000038755.1.41399 WP_000038755.1.41646 WP_000038755.1.41663 WP_000038755.1.41785 WP_000038755.1.41865 WP_000038755.1.42144 WP_000038755.1.4215 WP_000038755.1.42225 WP_000038755.1.42271 WP_000038755.1.42477 WP_000038755.1.42686 WP_000038755.1.42844 WP_000038755.1.43199 WP_000038755.1.4323 WP_000038755.1.43571 WP_000038755.1.43981 WP_000038755.1.44371 WP_000038755.1.44374 WP_000038755.1.4446 WP_000038755.1.44614 WP_000038755.1.44712 WP_000038755.1.44727 WP_000038755.1.44746 WP_000038755.1.44957 WP_000038755.1.45 WP_000038755.1.45058 WP_000038755.1.45103 WP_000038755.1.45150 WP_000038755.1.45180 WP_000038755.1.45540 WP_000038755.1.45553 WP_000038755.1.45733 WP_000038755.1.45790 WP_000038755.1.45896 WP_000038755.1.45976 WP_000038755.1.46116 WP_000038755.1.46790 WP_000038755.1.46992 WP_000038755.1.47044 WP_000038755.1.47485 WP_000038755.1.47608 WP_000038755.1.48052 WP_000038755.1.48239 WP_000038755.1.48592 WP_000038755.1.48911 WP_000038755.1.48916 WP_000038755.1.49082 WP_000038755.1.49278 WP_000038755.1.49280 WP_000038755.1.49421 WP_000038755.1.49423 WP_000038755.1.49501 WP_000038755.1.49508 WP_000038755.1.49689 WP_000038755.1.49888 WP_000038755.1.49965 WP_000038755.1.50082 WP_000038755.1.5019 WP_000038755.1.50326 WP_000038755.1.50352 WP_000038755.1.50420 WP_000038755.1.5055 WP_000038755.1.5063 WP_000038755.1.50874 WP_000038755.1.50880 WP_000038755.1.50943 WP_000038755.1.50959 WP_000038755.1.51004 WP_000038755.1.51102 WP_000038755.1.51114 WP_000038755.1.5137 WP_000038755.1.51547 WP_000038755.1.51570 WP_000038755.1.51780 WP_000038755.1.52139 WP_000038755.1.52273 WP_000038755.1.52401 WP_000038755.1.52470 WP_000038755.1.52514 WP_000038755.1.52634 WP_000038755.1.52729 WP_000038755.1.52826 WP_000038755.1.52916 WP_000038755.1.52981 WP_000038755.1.53013 WP_000038755.1.53080 WP_000038755.1.53087 WP_000038755.1.54107 WP_000038755.1.54228 WP_000038755.1.54244 WP_000038755.1.5437 WP_000038755.1.54416 WP_000038755.1.54423 WP_000038755.1.5451 WP_000038755.1.54629 WP_000038755.1.54752 WP_000038755.1.54818 WP_000038755.1.54821 WP_000038755.1.55451 WP_000038755.1.55542 WP_000038755.1.55643 WP_000038755.1.55655 WP_000038755.1.55673 WP_000038755.1.55702 WP_000038755.1.55753 WP_000038755.1.55878 WP_000038755.1.56043 WP_000038755.1.56208 WP_000038755.1.564 WP_000038755.1.56404 WP_000038755.1.56590 WP_000038755.1.56602 WP_000038755.1.56930 WP_000038755.1.57174 WP_000038755.1.57262 WP_000038755.1.57320 WP_000038755.1.57347 WP_000038755.1.57368 WP_000038755.1.57407 WP_000038755.1.57557 WP_000038755.1.57586 WP_000038755.1.57721 WP_000038755.1.57900 WP_000038755.1.58075 WP_000038755.1.58119 WP_000038755.1.58208 WP_000038755.1.58254 WP_000038755.1.58313 WP_000038755.1.59040 WP_000038755.1.59057 WP_000038755.1.59196 WP_000038755.1.59460 WP_000038755.1.59565 WP_000038755.1.5977 WP_000038755.1.59837 WP_000038755.1.5999 WP_000038755.1.60058 WP_000038755.1.60093 WP_000038755.1.60159 WP_000038755.1.6055 WP_000038755.1.60593 WP_000038755.1.60702 WP_000038755.1.6096 WP_000038755.1.61032 WP_000038755.1.61267 WP_000038755.1.61433 WP_000038755.1.61458 WP_000038755.1.61554 WP_000038755.1.61581 WP_000038755.1.61676 WP_000038755.1.61790 WP_000038755.1.61844 WP_000038755.1.62057 WP_000038755.1.62267 WP_000038755.1.62362 WP_000038755.1.62758 WP_000038755.1.63086 WP_000038755.1.6321 WP_000038755.1.63363 WP_000038755.1.63367 WP_000038755.1.63394 WP_000038755.1.63482 WP_000038755.1.6360 WP_000038755.1.63764 WP_000038755.1.6383 WP_000038755.1.63980 WP_000038755.1.63991 WP_000038755.1.64206 WP_000038755.1.64352 WP_000038755.1.64459 WP_000038755.1.64468 WP_000038755.1.64640 WP_000038755.1.64651 WP_000038755.1.64713 WP_000038755.1.64967 WP_000038755.1.64975 WP_000038755.1.65010 WP_000038755.1.65059 WP_000038755.1.65139 WP_000038755.1.65195 WP_000038755.1.6526 WP_000038755.1.65287 WP_000038755.1.65297 WP_000038755.1.65323 WP_000038755.1.65324 WP_000038755.1.65427 WP_000038755.1.6564 WP_000038755.1.65668 WP_000038755.1.65918 WP_000038755.1.66063 WP_000038755.1.66242 WP_000038755.1.66372 WP_000038755.1.66680 WP_000038755.1.66732 WP_000038755.1.66784 WP_000038755.1.67008 WP_000038755.1.67162 WP_000038755.1.67318 WP_000038755.1.67444 WP_000038755.1.67476 WP_000038755.1.67680 WP_000038755.1.67759 WP_000038755.1.67859 WP_000038755.1.68143 WP_000038755.1.68234 WP_000038755.1.68290 WP_000038755.1.6840 WP_000038755.1.68413 WP_000038755.1.68443 WP_000038755.1.68587 WP_000038755.1.68732 WP_000038755.1.68788 WP_000038755.1.68827 WP_000038755.1.68867 WP_000038755.1.68890 WP_000038755.1.69023 WP_000038755.1.69034 WP_000038755.1.69077 WP_000038755.1.69101 WP_000038755.1.69132 WP_000038755.1.69163 WP_000038755.1.69705 WP_000038755.1.6986 WP_000038755.1.70053 WP_000038755.1.70219 WP_000038755.1.70276 WP_000038755.1.70286 WP_000038755.1.70391 WP_000038755.1.70397 WP_000038755.1.70562 WP_000038755.1.70742 WP_000038755.1.70932 WP_000038755.1.71044 WP_000038755.1.71075 WP_000038755.1.71237 WP_000038755.1.71554 WP_000038755.1.71606 WP_000038755.1.71643 WP_000038755.1.71709 WP_000038755.1.7191 WP_000038755.1.7234 WP_000038755.1.72381 WP_000038755.1.72464 WP_000038755.1.72821 WP_000038755.1.72949 WP_000038755.1.73030 WP_000038755.1.73082 WP_000038755.1.73137 WP_000038755.1.73184 WP_000038755.1.73417 WP_000038755.1.73421 WP_000038755.1.73439 WP_000038755.1.73449 WP_000038755.1.7350 WP_000038755.1.73585 WP_000038755.1.73621 WP_000038755.1.73637 WP_000038755.1.73692 WP_000038755.1.73696 WP_000038755.1.73856 WP_000038755.1.74086 WP_000038755.1.74188 WP_000038755.1.74717 WP_000038755.1.74933 WP_000038755.1.74951 WP_000038755.1.75020 WP_000038755.1.75077 WP_000038755.1.75293 WP_000038755.1.75819 WP_000038755.1.7586 WP_000038755.1.7587 WP_000038755.1.75882 WP_000038755.1.76023 WP_000038755.1.76033 WP_000038755.1.76034 WP_000038755.1.7620 WP_000038755.1.76408 WP_000038755.1.76490 WP_000038755.1.76610 WP_000038755.1.76906 WP_000038755.1.76996 WP_000038755.1.77005 WP_000038755.1.77138 WP_000038755.1.77757 WP_000038755.1.77945 WP_000038755.1.78006 WP_000038755.1.78251 WP_000038755.1.78262 WP_000038755.1.78292 WP_000038755.1.7835 WP_000038755.1.78356 WP_000038755.1.78432 WP_000038755.1.78464 WP_000038755.1.78480 WP_000038755.1.7882 WP_000038755.1.78990 WP_000038755.1.7904 WP_000038755.1.791 WP_000038755.1.79117 WP_000038755.1.79135 WP_000038755.1.79372 WP_000038755.1.79474 WP_000038755.1.79724 WP_000038755.1.80180 WP_000038755.1.80340 WP_000038755.1.80438 WP_000038755.1.80460 WP_000038755.1.80706 WP_000038755.1.8099 WP_000038755.1.81006 WP_000038755.1.81080 WP_000038755.1.81115 WP_000038755.1.81168 WP_000038755.1.81280 WP_000038755.1.81303 WP_000038755.1.81477 WP_000038755.1.81506 WP_000038755.1.82198 WP_000038755.1.825 WP_000038755.1.82501 WP_000038755.1.82730 WP_000038755.1.82982 WP_000038755.1.83071 WP_000038755.1.83198 WP_000038755.1.8340 WP_000038755.1.83465 WP_000038755.1.83494 WP_000038755.1.83616 WP_000038755.1.8362 WP_000038755.1.83944 WP_000038755.1.84093 WP_000038755.1.84119 WP_000038755.1.84227 WP_000038755.1.84273 WP_000038755.1.84289 WP_000038755.1.84343 WP_000038755.1.84707 WP_000038755.1.85030 WP_000038755.1.85179 WP_000038755.1.852 WP_000038755.1.85296 WP_000038755.1.85605 WP_000038755.1.85914 WP_000038755.1.85946 WP_000038755.1.85966 WP_000038755.1.8625 WP_000038755.1.86366 WP_000038755.1.86500 WP_000038755.1.86532 WP_000038755.1.86535 WP_000038755.1.86635 WP_000038755.1.86651 WP_000038755.1.86986 WP_000038755.1.87011 WP_000038755.1.87030 WP_000038755.1.87033 WP_000038755.1.87251 WP_000038755.1.87307 WP_000038755.1.87380 WP_000038755.1.87395 WP_000038755.1.87807 WP_000038755.1.87880 WP_000038755.1.87882 WP_000038755.1.88071 WP_000038755.1.88209 WP_000038755.1.88262 WP_000038755.1.88296 WP_000038755.1.88344 WP_000038755.1.88345 WP_000038755.1.8861 WP_000038755.1.887 WP_000038755.1.88701 WP_000038755.1.88744 WP_000038755.1.88855 WP_000038755.1.89248 WP_000038755.1.89303 WP_000038755.1.89336 WP_000038755.1.89477 WP_000038755.1.89574 WP_000038755.1.89608 WP_000038755.1.89838 WP_000038755.1.89890 WP_000038755.1.90068 WP_000038755.1.90074 WP_000038755.1.90129 WP_000038755.1.90214 WP_000038755.1.90411 WP_000038755.1.90530 WP_000038755.1.90664 WP_000038755.1.90666 WP_000038755.1.90749 WP_000038755.1.90867 WP_000038755.1.90941 WP_000038755.1.91002 WP_000038755.1.91223 WP_000038755.1.91270 WP_000038755.1.91285 WP_000038755.1.9136 WP_000038755.1.91673 WP_000038755.1.91731 WP_000038755.1.92126 WP_000038755.1.92152 WP_000038755.1.92184 WP_000038755.1.92219 WP_000038755.1.92320 WP_000038755.1.92547 WP_000038755.1.92590 WP_000038755.1.92647 WP_000038755.1.92684 WP_000038755.1.92762 WP_000038755.1.9295 WP_000038755.1.93080 WP_000038755.1.933 WP_000038755.1.93303 WP_000038755.1.93323 WP_000038755.1.93537 WP_000038755.1.93734 WP_000038755.1.93793 WP_000038755.1.93825 WP_000038755.1.9386 WP_000038755.1.93881 WP_000038755.1.93884 WP_000038755.1.94109 WP_000038755.1.94194 WP_000038755.1.94346 WP_000038755.1.94370 WP_000038755.1.94457 WP_000038755.1.94532 WP_000038755.1.94803 WP_000038755.1.94868 WP_000038755.1.94973 WP_000038755.1.95328 WP_000038755.1.95394 WP_000038755.1.95658 WP_000038755.1.95950 WP_000038755.1.96087 WP_000038755.1.96116 WP_000038755.1.96137 WP_000038755.1.96406 WP_000038755.1.96485 WP_000038755.1.96768 WP_000038755.1.96868 WP_000038755.1.96943 WP_000038755.1.96986 WP_000038755.1.9711 WP_000038755.1.97166 WP_000038755.1.9741 WP_000038755.1.97621 WP_000038755.1.97836 WP_000038755.1.97838 WP_000038755.1.97850 WP_000038755.1.98063 WP_000038755.1.98185 WP_000038755.1.9822 WP_000038755.1.98264 WP_000038755.1.98346 WP_000038755.1.98370 WP_000038755.1.98584 WP_000038755.1.98638 WP_000038755.1.98766 WP_000038755.1.98773 WP_000038755.1.98832 WP_000038755.1.98979 WP_000038755.1.99017 WP_000038755.1.99019 WP_000038755.1.99056 WP_000038755.1.99241 WP_000038755.1.99286 WP_000038755.1.99447 WP_000038755.1.99728 WP_000038755.1.99946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]