SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787024|ref|YP_329498.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787024|ref|YP_329498.1|
Domain Number 1 Region: 156-495
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.87e-119
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000183
Further Details:      
 
Domain Number 2 Region: 8-149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.16e-44
Family Anticodon-binding domain 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76787024|ref|YP_329498.1|
Sequence length 496
Comment lysyl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MSNQHIEELNDQQIVRREKMAALTEQGIDPFGKRFERTATSGQLNEKYADKSKEDLHDIE
ETATIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDSVGEENYEIFKKADLGDFLGVEG
QVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDIETIYRKRHLDLISNRDSFDRFVT
RSKIISEIRRFMDSNGFLEVETPVLHNEAGGASARPFITHHNAQDIDMVLRIATELHLKR
LIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEAYQAYADYQDIMDLTEGIIQHVTKTVK
GDGPINYQGTEIKINEPFKRVHMVDAVKEITGIDFWKEMTLEEAQALAQEKNVPLEKHFT
TVGHIINAFFEEFVEDTLIQPTFVFGHPVEVSPLAKKNDTDPRFTDRFELFVMTKEYANA
FTELNDPIDQLSRFEAQASAKELGDDEATGVDYDYVEALEYGMPPTGGLGIGIDRLCMLL
TDTTTIRDVLLFPTMK
Download sequence
Identical sequences Q3K1V5
205921.SAK_0876 gi|76787024|ref|YP_329498.1| WP_000070709.1.12166 WP_000070709.1.12978 WP_000070709.1.20188 WP_000070709.1.22004 WP_000070709.1.30710 WP_000070709.1.32728 WP_000070709.1.34906 WP_000070709.1.36878 WP_000070709.1.3963 WP_000070709.1.45150 WP_000070709.1.47485 WP_000070709.1.48239 WP_000070709.1.57721 WP_000070709.1.59565 WP_000070709.1.61790 WP_000070709.1.67008 WP_000070709.1.69101 WP_000070709.1.79135 WP_000070709.1.81168 WP_000070709.1.81506 WP_000070709.1.83616 WP_000070709.1.87033 WP_000070709.1.89303 WP_000070709.1.90530 WP_000070709.1.90666 WP_000070709.1.90941 WP_000070709.1.933 WP_000070709.1.94370 gi|406709243|ref|YP_006763969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]